| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
| Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
| Protein automated matches [227009] (16 species) not a true protein |
| Species Bacillus fastidiosus [TaxId:1458] [273141] (2 PDB entries) |
| Domain d4r99c1: 4r99 C:3-154 [273150] Other proteins in same PDB: d4r99a3, d4r99a4, d4r99b3, d4r99b4, d4r99c3, d4r99d3, d4r99d4 automated match to d1j2ga1 complexed with so4 |
PDB Entry: 4r99 (more details), 1.8 Å
SCOPe Domain Sequences for d4r99c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r99c1 d.96.1.0 (C:3-154) automated matches {Bacillus fastidiosus [TaxId: 1458]}
rtmfygkgdvyvfrtyanplkglkqipesnftekhntifgmnakvalkgeqlltsftegd
nslvvatdsmknfiqrhaasyegatlegflqyvceaflakyshldavrleakeyafddiq
vgtdkgvvtsdlvfrksrneyvtatvevarta
Timeline for d4r99c1: