SCOPe 2.05: Domain d4qgna_: 4qgn A:

Lineage for d4qgna_ (4qgn A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.6: Acireductone dioxygenase [82191] (2 proteins)
   automatically mapped to Pfam PF03079

6. Protein automated matches [273135] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [273136] (1 PDB entry)

8. Domain d4qgna_: 4qgn A: [273137]
   automated match to d1vr3a1
   complexed with act, cl, fe, mse, so4

Details for d4qgna_

PDB Entry: 4qgn, 3.05 Å

PDB Description: human acireductone dioxygenase with iron ion and l-methionine in active center

PDB Compounds: (A:) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase

SCOPe Domain Sequences for d4qgna_:

Sequence; same for both SEQRES and ATOM records:

>d4qgna_ b.82.1.6 (A:) automated matches {Homo sapiens [TaxId: 9606]}
mvqawymddapgdprqphrpdpgrpvgleqlrrlgvlywkldadkyendpelekirrern
yswmdiitickdklpnyeekikmfyeehlhlddeiryildgsgyfdvrdkedqwirifme
kgdmvtlpagiyhrftvdeknytkamrlfvgepvwtaynrpadhfeargqyvkflaqt

Timeline for d4qgna_:

• d4qgna_ is new in SCOPe 2.05-stable
  
• d4qgna_ appears in SCOPe 2.06
  
• d4qgna_ appears in the current release, SCOPe 2.08