Lineage for d4qgna_ (4qgn A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404008Family b.82.1.6: Acireductone dioxygenase [82191] (2 protein domains)
    automatically mapped to Pfam PF03079
  6. 2404019Protein automated matches [273135] (1 species)
    not a true protein
  7. 2404020Species Human (Homo sapiens) [TaxId:9606] [273136] (1 PDB entry)
  8. 2404021Domain d4qgna_: 4qgn A: [273137]
    automated match to d1vr3a1
    complexed with act, cl, fe, mse, so4

Details for d4qgna_

PDB Entry: 4qgn (more details), 3.05 Å

PDB Description: human acireductone dioxygenase with iron ion and l-methionine in active center
PDB Compounds: (A:) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase

SCOPe Domain Sequences for d4qgna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qgna_ b.82.1.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvqawymddapgdprqphrpdpgrpvgleqlrrlgvlywkldadkyendpelekirrern
yswmdiitickdklpnyeekikmfyeehlhlddeiryildgsgyfdvrdkedqwirifme
kgdmvtlpagiyhrftvdeknytkamrlfvgepvwtaynrpadhfeargqyvkflaqt

SCOPe Domain Coordinates for d4qgna_:

Click to download the PDB-style file with coordinates for d4qgna_.
(The format of our PDB-style files is described here.)

Timeline for d4qgna_: