SCOPe 2.07: Domain d4pnfc2: 4pnf C:88-221

Lineage for d4pnfc2 (4pnf C:88-221)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (16 PDB entries)

8. Domain d4pnfc2: 4pnf C:88-221 [273134]
   Other proteins in same PDB: d4pnfa1, d4pnfb1, d4pnfc1, d4pnfd1, d4pnfe1, d4pnff1, d4pnfg1, d4pnfh1
   automated match to d4hi7b2
   complexed with gsh

Details for d4pnfc2

PDB Entry: 4pnf, 2.11 Å

PDB Description: glutathione s-transferase from drosophila melanogaster - isozyme e6

PDB Compounds: (C:) RE21095p

SCOPe Domain Sequences for d4pnfc2:

Sequence; same for both SEQRES and ATOM records:

>d4pnfc2 a.45.1.0 (C:88-221) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kdplkravvdqrlhfesgvvfangirsisksvlfqgqtkvpkerydaiieiydfvetflk
gqdyiagnqltiadfslvssvasleafvaldttkyprigawikkleqlpyyeeangkgvr
qlvaifkktnftfe

Timeline for d4pnfc2:

• d4pnfc2 first appeared in SCOPe 2.05
  
• d4pnfc2 appears in SCOPe 2.06
  
• d4pnfc2 appears in the current release, SCOPe 2.08