![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (17 PDB entries) |
![]() | Domain d4pnfe2: 4pnf E:88-222 [273132] Other proteins in same PDB: d4pnfa1, d4pnfb1, d4pnfc1, d4pnfd1, d4pnfe1, d4pnff1, d4pnfg1, d4pnfh1 automated match to d4hi7b2 complexed with gsh |
PDB Entry: 4pnf (more details), 2.11 Å
SCOPe Domain Sequences for d4pnfe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pnfe2 a.45.1.0 (E:88-222) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} kdplkravvdqrlhfesgvvfangirsisksvlfqgqtkvpkerydaiieiydfvetflk gqdyiagnqltiadfslvssvasleafvaldttkyprigawikkleqlpyyeeangkgvr qlvaifkktnftfea
Timeline for d4pnfe2: