Lineage for d4pnfh2 (4pnf H:88-221)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1735625Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1735626Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1736416Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1736417Protein automated matches [226831] (51 species)
    not a true protein
  7. 1736561Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (6 PDB entries)
  8. 1736575Domain d4pnfh2: 4pnf H:88-221 [273131]
    Other proteins in same PDB: d4pnfa1, d4pnfb1, d4pnfc1, d4pnfd1, d4pnfe1, d4pnff1, d4pnfg1, d4pnfh1
    automated match to d4hi7b2

Details for d4pnfh2

PDB Entry: 4pnf (more details), 2.11 Å

PDB Description: glutathione s-transferase from drosophila melanogaster - isozyme e6
PDB Compounds: (H:) RE21095p

SCOPe Domain Sequences for d4pnfh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pnfh2 a.45.1.0 (H:88-221) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kdplkravvdqrlhfesgvvfangirsisksvlfqgqtkvpkerydaiieiydfvetflk
gqdyiagnqltiadfslvssvasleafvaldttkyprigawikkleqlpyyeeangkgvr
qlvaifkktnftfe

SCOPe Domain Coordinates for d4pnfh2:

Click to download the PDB-style file with coordinates for d4pnfh2.
(The format of our PDB-style files is described here.)

Timeline for d4pnfh2: