| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (18 PDB entries) |
| Domain d4pnfe1: 4pnf E:3-87 [273125] Other proteins in same PDB: d4pnfa2, d4pnfb2, d4pnfc2, d4pnfd2, d4pnfe2, d4pnff2, d4pnfg2, d4pnfh2 automated match to d4hi7b1 complexed with gsh |
PDB Entry: 4pnf (more details), 2.11 Å
SCOPe Domain Sequences for d4pnfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pnfe1 c.47.1.0 (E:3-87) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptleddg
hyiwdshaiiaylvskyadsdalyp
Timeline for d4pnfe1: