SCOPe 2.08: Domain d4pnga2: 4png A:88-223

Lineage for d4pnga2 (4png A:88-223)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (17 PDB entries)

8. Domain d4pnga2: 4png A:88-223 [273124]
   Other proteins in same PDB: d4pnga1, d4pngb1
   automated match to d4hi7b2
   complexed with gsf

Details for d4pnga2

PDB Entry: 4png, 1.53 Å

PDB Description: glutathione s-transferase from drosophila melanogaster - isozyme e7

PDB Compounds: (A:) LD04004p

SCOPe Domain Sequences for d4pnga2:

Sequence; same for both SEQRES and ATOM records:

>d4pnga2 a.45.1.0 (A:88-223) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kdllqravvdqrlhfesgvifanalrsitkplfagkqtmipkerydaiievydflekfla
gndyvagnqltiadfsiistvsslevfvkvdttkypriaawfkrlqklpyyeeangngar
tfesfireynftfasn

Timeline for d4pnga2:

• d4pnga2 first appeared in SCOPe 2.05
  
• d4pnga2 appears in SCOPe 2.07