SCOPe 2.08: Domain d4pnfb1: 4pnf B:2-87

Lineage for d4pnfb1 (4pnf B:2-87)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (18 PDB entries)

8. Domain d4pnfb1: 4pnf B:2-87 [273121]
   Other proteins in same PDB: d4pnfa2, d4pnfb2, d4pnfc2, d4pnfd2, d4pnfe2, d4pnff2, d4pnfg2, d4pnfh2
   automated match to d4hi7b1
   complexed with gsh

Details for d4pnfb1

PDB Entry: 4pnf, 2.11 Å

PDB Description: glutathione s-transferase from drosophila melanogaster - isozyme e6

PDB Compounds: (B:) RE21095p

SCOPe Domain Sequences for d4pnfb1:

Sequence; same for both SEQRES and ATOM records:

>d4pnfb1 c.47.1.0 (B:2-87) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vkltlygldpsppvravkltlaalnltyeyvnvdivaraqlspeyleknpqhtvptledd
ghyiwdshaiiaylvskyadsdalyp

Timeline for d4pnfb1:

• d4pnfb1 first appeared in SCOPe 2.05
  
• d4pnfb1 appears in SCOPe 2.07