Lineage for d4pnga1 (4png A:3-87)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879500Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (18 PDB entries)
  8. 2879517Domain d4pnga1: 4png A:3-87 [273118]
    Other proteins in same PDB: d4pnga2, d4pngb2
    automated match to d4hi7b1
    complexed with gsf

Details for d4pnga1

PDB Entry: 4png (more details), 1.53 Å

PDB Description: glutathione s-transferase from drosophila melanogaster - isozyme e7
PDB Compounds: (A:) LD04004p

SCOPe Domain Sequences for d4pnga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pnga1 c.47.1.0 (A:3-87) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
klilygleasppvravkltlaalevpyefvevntrakenfseeflkknpqhtvptleddg
hyiwdshaiiaylvskygktdslyp

SCOPe Domain Coordinates for d4pnga1:

Click to download the PDB-style file with coordinates for d4pnga1.
(The format of our PDB-style files is described here.)

Timeline for d4pnga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4pnga2