Lineage for d4pnfa2 (4pnf A:88-221)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713957Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (17 PDB entries)
  8. 2713987Domain d4pnfa2: 4pnf A:88-221 [273116]
    Other proteins in same PDB: d4pnfa1, d4pnfb1, d4pnfc1, d4pnfd1, d4pnfe1, d4pnff1, d4pnfg1, d4pnfh1
    automated match to d4hi7b2
    complexed with gsh

Details for d4pnfa2

PDB Entry: 4pnf (more details), 2.11 Å

PDB Description: glutathione s-transferase from drosophila melanogaster - isozyme e6
PDB Compounds: (A:) RE21095p

SCOPe Domain Sequences for d4pnfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pnfa2 a.45.1.0 (A:88-221) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kdplkravvdqrlhfesgvvfangirsisksvlfqgqtkvpkerydaiieiydfvetflk
gqdyiagnqltiadfslvssvasleafvaldttkyprigawikkleqlpyyeeangkgvr
qlvaifkktnftfe

SCOPe Domain Coordinates for d4pnfa2:

Click to download the PDB-style file with coordinates for d4pnfa2.
(The format of our PDB-style files is described here.)

Timeline for d4pnfa2: