SCOPe 2.08: Domain d4d2kd1: 4d2k D:8-84

Lineage for d4d2kd1 (4d2k D:8-84)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (3 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.0: automated matches [254229] (1 protein)
   not a true family

6. Protein automated matches [254518] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [273108] (1 PDB entry)

8. Domain d4d2kd1: 4d2k D:8-84 [273114]
   Other proteins in same PDB: d4d2ka2, d4d2kb2, d4d2kc2, d4d2kd2
   automated match to d4maca_

Details for d4d2kd1

PDB Entry: 4d2k, 2.3 Å

PDB Description: crystal structure of drep2 cide domain

PDB Compounds: (D:) drep2

SCOPe Domain Sequences for d4d2kd1:

Sequence; same for both SEQRES and ATOM records:

>d4d2kd1 d.15.2.0 (D:8-84) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gkrplkiwdswrnvrkgvvvgtfeellvrgkdklgvpasepvrvvlecdgtqiedgeyfr
tlanntvllllrqgerw

Timeline for d4d2kd1:

• d4d2kd1 first appeared in SCOPe 2.05, called d4d2kd_
  
• d4d2kd1 appears in SCOPe 2.07