![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) ![]() contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
![]() | Family d.15.2.0: automated matches [254229] (1 protein) not a true family |
![]() | Protein automated matches [254518] (3 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [273108] (1 PDB entry) |
![]() | Domain d4d2ka1: 4d2k A:7-84 [273111] Other proteins in same PDB: d4d2ka2, d4d2kb2, d4d2kc2, d4d2kd2 automated match to d4maca_ |
PDB Entry: 4d2k (more details), 2.3 Å
SCOPe Domain Sequences for d4d2ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d2ka1 d.15.2.0 (A:7-84) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} rgkrplkiwdswrnvrkgvvvgtfeellvrgkdklgvpasepvrvvlecdgtqiedgeyf rtlanntvllllrqgerw
Timeline for d4d2ka1: