Lineage for d4d2ka1 (4d2k A:7-84)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933606Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 2933693Family d.15.2.0: automated matches [254229] (1 protein)
    not a true family
  6. 2933694Protein automated matches [254518] (3 species)
    not a true protein
  7. 2933695Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [273108] (1 PDB entry)
  8. 2933696Domain d4d2ka1: 4d2k A:7-84 [273111]
    Other proteins in same PDB: d4d2ka2, d4d2kb2, d4d2kc2, d4d2kd2
    automated match to d4maca_

Details for d4d2ka1

PDB Entry: 4d2k (more details), 2.3 Å

PDB Description: crystal structure of drep2 cide domain
PDB Compounds: (A:) drep2

SCOPe Domain Sequences for d4d2ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d2ka1 d.15.2.0 (A:7-84) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rgkrplkiwdswrnvrkgvvvgtfeellvrgkdklgvpasepvrvvlecdgtqiedgeyf
rtlanntvllllrqgerw

SCOPe Domain Coordinates for d4d2ka1:

Click to download the PDB-style file with coordinates for d4d2ka1.
(The format of our PDB-style files is described here.)

Timeline for d4d2ka1: