SCOPe 2.06: Domain d1srjb_: 1srj B:

Lineage for d1srjb_ (1srj B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (125 PDB entries)

8. Domain d1srjb_: 1srj B: [27311]
   complexed with nab

Details for d1srjb_

PDB Entry: 1srj, 1.8 Å

PDB Description: structure-based design of synthetic azobenzene ligands for streptavidin

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1srjb_:

Sequence, based on SEQRES records:

>d1srjb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records):

>d1srjb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
agitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapasgtalgwtv
awknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Timeline for d1srjb_:

• d1srjb_ first appeared (with stable ids) in SCOP 1.55
  
• d1srjb_ appears in SCOPe 2.05
  
• d1srjb_ appears in SCOPe 2.07
  
• d1srjb_ appears in the current release, SCOPe 2.08