Lineage for d4zfol2 (4zfo L:108-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759918Domain d4zfol2: 4zfo L:108-214 [273106]
    Other proteins in same PDB: d4zfob2, d4zfof_, d4zfok_
    automated match to d1e4wl2
    complexed with btb, cu

Details for d4zfol2

PDB Entry: 4zfo (more details), 1.9 Å

PDB Description: j22.9-xi: chimeric mouse/human antibody against human bcma (cd269)
PDB Compounds: (L:) J22.9-xi Fab, Light Chain

SCOPe Domain Sequences for d4zfol2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zfol2 b.1.1.0 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgea

SCOPe Domain Coordinates for d4zfol2:

Click to download the PDB-style file with coordinates for d4zfol2.
(The format of our PDB-style files is described here.)

Timeline for d4zfol2: