Lineage for d4zfob2 (4zfo B:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752594Domain d4zfob2: 4zfo B:107-213 [273104]
    Other proteins in same PDB: d4zfob1, d4zfof_, d4zfok_, d4zfol1, d4zfol2
    automated match to d3cfja2
    complexed with btb, cu

Details for d4zfob2

PDB Entry: 4zfo (more details), 1.9 Å

PDB Description: j22.9-xi: chimeric mouse/human antibody against human bcma (cd269)
PDB Compounds: (B:) J22.9-xi Fab, Light Chain

SCOPe Domain Sequences for d4zfob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zfob2 b.1.1.2 (B:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4zfob2:

Click to download the PDB-style file with coordinates for d4zfob2.
(The format of our PDB-style files is described here.)

Timeline for d4zfob2: