Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d4zfob2: 4zfo B:107-213 [273104] Other proteins in same PDB: d4zfob1, d4zfof_, d4zfok_, d4zfol1, d4zfol2 automated match to d3cfja2 complexed with btb, cu |
PDB Entry: 4zfo (more details), 1.9 Å
SCOPe Domain Sequences for d4zfob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zfob2 b.1.1.2 (B:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d4zfob2:
View in 3D Domains from other chains: (mouse over for more information) d4zfof_, d4zfok_, d4zfol1, d4zfol2 |