SCOPe 2.08: Domain d4zfob2: 4zfo B:107-213

Lineage for d4zfob2 (4zfo B:107-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4zfob2: 4zfo B:107-213 [273104]
   Other proteins in same PDB: d4zfob1, d4zfof_, d4zfok_, d4zfol1, d4zfol2
   automated match to d3cfja2
   complexed with btb, cu

Details for d4zfob2

PDB Entry: 4zfo, 1.9 Å

PDB Description: j22.9-xi: chimeric mouse/human antibody against human bcma (cd269)

PDB Compounds: (B:) J22.9-xi Fab, Light Chain

SCOPe Domain Sequences for d4zfob2:

Sequence; same for both SEQRES and ATOM records:

>d4zfob2 b.1.1.2 (B:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4zfob2:

• d4zfob2 first appeared in SCOPe 2.05
  
• d4zfob2 appears in SCOPe 2.07