Lineage for d1srja_ (1srj A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2063611Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2063612Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2063637Protein Streptavidin [50878] (1 species)
  7. 2063638Species Streptomyces avidinii [TaxId:1895] [50879] (125 PDB entries)
  8. 2063785Domain d1srja_: 1srj A: [27310]
    complexed with nab

Details for d1srja_

PDB Entry: 1srj (more details), 1.8 Å

PDB Description: structure-based design of synthetic azobenzene ligands for streptavidin
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d1srja_:

Sequence, based on SEQRES records: (download)

>d1srja_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
v

Sequence, based on observed residues (ATOM records): (download)

>d1srja_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapasgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

SCOPe Domain Coordinates for d1srja_:

Click to download the PDB-style file with coordinates for d1srja_.
(The format of our PDB-style files is described here.)

Timeline for d1srja_: