SCOPe 2.06: Domain d4znza_: 4znz A:

Lineage for d4znza_ (4znz A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)

6. Protein beta-carbonic anhydrase [53058] (4 species)

7. Species Escherichia coli [TaxId:562] [64085] (4 PDB entries)
   Uniprot P61517

8. Domain d4znza_: 4znz A: [273099]
   automated match to d1i6pa_
   complexed with zn

Details for d4znza_

PDB Entry: 4znz, 2.7 Å

PDB Description: crystal structure of escherichia coli carbonic anhydrase (yadf) in complex with zn - artifact of purification

PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d4znza_:

Sequence; same for both SEQRES and ATOM records:

>d4znza_ c.53.2.1 (A:) beta-carbonic anhydrase {Escherichia coli [TaxId: 562]}
kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
vhrnvanlvihtdlnclsvvqyavdvlevehiiicghygcggvqaavenpelglinnwll
hirdiwfkhssllgempqerrldtlcelnvmeqvynlghstimqsawkrgqkvtihgway
gihdgllrdldvtatnretleqryrhgisnlklkh

Timeline for d4znza_:

• d4znza_ first appeared in SCOPe 2.05
  
• d4znza_ appears in SCOPe 2.07
  
• d4znza_ appears in the current release, SCOPe 2.08