Lineage for d4zj2a1 (4zj2 A:26-290)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2618634Protein beta-Lactamase, class A [56606] (16 species)
  7. 2618665Species Escherichia coli, TEM-1 [TaxId:562] [56607] (62 PDB entries)
  8. 2618736Domain d4zj2a1: 4zj2 A:26-290 [273098]
    Other proteins in same PDB: d4zj2a2
    automated match to d1zg4a_
    mutant

Details for d4zj2a1

PDB Entry: 4zj2 (more details), 1.8 Å

PDB Description: crystal structure of p-acrylamido-phenylalanine modified tem1 beta- lactamase from escherichia coli :e166n mutant
PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d4zj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zj2a1 e.3.1.1 (A:26-290) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmxtfkvllcgavlsrid
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwnpelneaipnderdttmpvamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOPe Domain Coordinates for d4zj2a1:

Click to download the PDB-style file with coordinates for d4zj2a1.
(The format of our PDB-style files is described here.)

Timeline for d4zj2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zj2a2