SCOPe 2.08: Domain d4zj1a1: 4zj1 A:26-290

Lineage for d4zj1a1 (4zj1 A:26-290)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (63 PDB entries)

8. Domain d4zj1a1: 4zj1 A:26-290 [273097]
   Other proteins in same PDB: d4zj1a2
   automated match to d1zg4a_
   complexed with gol, mes, peg; mutant

Details for d4zj1a1

PDB Entry: 4zj1, 1.54 Å

PDB Description: crystal structure of p-acrylamido-phenylalanine modified tem1 beta- lactamase from escherichia coli : v216acrf mutant

PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d4zj1a1:

Sequence; same for both SEQRES and ATOM records:

>d4zj1a1 e.3.1.1 (A:26-290) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrid
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrq
qlidwmeadkxagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d4zj1a1:

• d4zj1a1 first appeared in SCOPe 2.05, called d4zj1a_
  
• d4zj1a1 appears in SCOPe 2.07