SCOPe 2.08: Domain d4zjpa1: 4zjp A:24-292

Lineage for d4zjpa1 (4zjp A:24-292)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190296] (11 species)
   not a true protein

7. Species Actinobacillus succinogenes [TaxId:339671] [273094] (1 PDB entry)

8. Domain d4zjpa1: 4zjp A:24-292 [273095]
   Other proteins in same PDB: d4zjpa2
   automated match to d1dbpa_
   complexed with edo, rip

Details for d4zjpa1

PDB Entry: 4zjp, 1.63 Å

PDB Description: structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose

PDB Compounds: (A:) Monosaccharide-transporting ATPase

SCOPe Domain Sequences for d4zjpa1:

Sequence; same for both SEQRES and ATOM records:

>d4zjpa1 c.93.1.1 (A:24-292) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
qetialtvstldnpffvslkdgaqkkatelgyklvvldsqndpskelsnvedltvrgakv
llinptdsaavsnavaianrnkipvitldrgaakgevvshiasdnvaggkmagdfiaqkl
gdgakviqleglagtsaarergegfkqaieahkfdvlasqpadfdrtkglnvtenllask
gsvqaifaqndemalgalraisaagkkvlvvgfdgtedgvkavksgklaatvaqqpelig
slgvetadkilkgekvdakipvalkvvte

Timeline for d4zjpa1:

• d4zjpa1 first appeared in SCOPe 2.05, called d4zjpa_
  
• d4zjpa1 appears in SCOPe 2.07