Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
Protein automated matches [190296] (11 species) not a true protein |
Species Actinobacillus succinogenes [TaxId:339671] [273094] (1 PDB entry) |
Domain d4zjpa1: 4zjp A:24-292 [273095] Other proteins in same PDB: d4zjpa2 automated match to d1dbpa_ complexed with edo, rip |
PDB Entry: 4zjp (more details), 1.63 Å
SCOPe Domain Sequences for d4zjpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zjpa1 c.93.1.1 (A:24-292) automated matches {Actinobacillus succinogenes [TaxId: 339671]} qetialtvstldnpffvslkdgaqkkatelgyklvvldsqndpskelsnvedltvrgakv llinptdsaavsnavaianrnkipvitldrgaakgevvshiasdnvaggkmagdfiaqkl gdgakviqleglagtsaarergegfkqaieahkfdvlasqpadfdrtkglnvtenllask gsvqaifaqndemalgalraisaagkkvlvvgfdgtedgvkavksgklaatvaqqpelig slgvetadkilkgekvdakipvalkvvte
Timeline for d4zjpa1: