Lineage for d4zc1d_ (4zc1 D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839588Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1839934Family c.23.13.0: automated matches [191662] (1 protein)
    not a true family
  6. 1839935Protein automated matches [191250] (3 species)
    not a true protein
  7. 1839936Species Acinetobacter baumannii [TaxId:400667] [260788] (3 PDB entries)
  8. 1839952Domain d4zc1d_: 4zc1 D: [273079]
    automated match to d4rc9d_

Details for d4zc1d_

PDB Entry: 4zc1 (more details), 2.52 Å

PDB Description: crystal structure of type ii dehydroquinate dehydratase from acinetobacter baumannii with a different crystal form at 2.52 a resolution
PDB Compounds: (D:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4zc1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zc1d_ c.23.13.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
kaigvicglgakgysfaldyaiekiq

SCOPe Domain Coordinates for d4zc1d_:

Click to download the PDB-style file with coordinates for d4zc1d_.
(The format of our PDB-style files is described here.)

Timeline for d4zc1d_: