SCOPe 2.05: Domain d4z6ia_: 4z6i A:

Lineage for d4z6ia_ (4z6i A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (258 PDB entries)

8. Domain d4z6ia_: 4z6i A: [273073]
   automated match to d3hmeb_
   complexed with 4l3

Details for d4z6ia_

PDB Entry: 4z6i, 1.95 Å

PDB Description: crystal structure of brd9 bromodomain in complex with a substituted valerolactam quinolone ligand

PDB Compounds: (A:) Bromodomain-containing protein 9

SCOPe Domain Sequences for d4z6ia_:

Sequence; same for both SEQRES and ATOM records:

>d4z6ia_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkrsms

Timeline for d4z6ia_:

• d4z6ia_ is new in SCOPe 2.05-stable
  
• d4z6ia_ appears in SCOPe 2.06
  
• d4z6ia_ appears in the current release, SCOPe 2.08