Lineage for d4z19a2 (4z19 A:175-316)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525646Species Yersinia pestis [TaxId:632] [226052] (4 PDB entries)
  8. 2525648Domain d4z19a2: 4z19 A:175-316 [273066]
    automated match to d1ebla2
    complexed with gol

Details for d4z19a2

PDB Entry: 4z19 (more details), 1.8 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d4z19a2:

Sequence, based on SEQRES records: (download)

>d4z19a2 c.95.1.0 (A:175-316) automated matches {Yersinia pestis [TaxId: 632]}
msthlhadgrygellalpypdrqqdqpayvtmagnevfkvavtelahivdetlqvnnldr
taldwlvphqanlriisatakklgmgmdkvvitldrhgntsaasvpsafdeavrdgriqr
gqlvlleafgggftwgsalvrf

Sequence, based on observed residues (ATOM records): (download)

>d4z19a2 c.95.1.0 (A:175-316) automated matches {Yersinia pestis [TaxId: 632]}
msthlhadgrygellalpypayvtmagnevfkvavtelahivdetlqvnnldrtaldwlv
phqanlriisatakklgmgmdkvvitldrhgntsaasvpsafdeavrdgriqrgqlvlle
afgggftwgsalvrf

SCOPe Domain Coordinates for d4z19a2:

Click to download the PDB-style file with coordinates for d4z19a2.
(The format of our PDB-style files is described here.)

Timeline for d4z19a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4z19a1