Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Yersinia pestis [TaxId:632] [226052] (4 PDB entries) |
Domain d4z19a1: 4z19 A:1-174 [273065] automated match to d1hnja1 complexed with gol |
PDB Entry: 4z19 (more details), 1.8 Å
SCOPe Domain Sequences for d4z19a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z19a1 c.95.1.0 (A:1-174) automated matches {Yersinia pestis [TaxId: 632]} mytkilgtgsylpvqvrsnadlekmvdtsdewivtrtgirerriagldetvatmgfqaae kalemagidkddigliivattssshafpssacqvqrmlgikdaasfdlaaacagftyals vadqyvksgavkhaivigsdvlsraldpedrgtiilfgdgagavvlgaseqpgi
Timeline for d4z19a1: