SCOPe 2.08: Domain d4z19a1: 4z19 A:1-174

Lineage for d4z19a1 (4z19 A:1-174)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226052] (4 PDB entries)

8. Domain d4z19a1: 4z19 A:1-174 [273065]
   automated match to d1hnja1
   complexed with gol

Details for d4z19a1

PDB Entry: 4z19, 1.8 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 3

SCOPe Domain Sequences for d4z19a1:

Sequence; same for both SEQRES and ATOM records:

>d4z19a1 c.95.1.0 (A:1-174) automated matches {Yersinia pestis [TaxId: 632]}
mytkilgtgsylpvqvrsnadlekmvdtsdewivtrtgirerriagldetvatmgfqaae
kalemagidkddigliivattssshafpssacqvqrmlgikdaasfdlaaacagftyals
vadqyvksgavkhaivigsdvlsraldpedrgtiilfgdgagavvlgaseqpgi

Timeline for d4z19a1:

• d4z19a1 first appeared in SCOPe 2.05
  
• d4z19a1 appears in SCOPe 2.07