Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (27 species) not a true protein |
Species Entamoeba histolytica [TaxId:294381] [273048] (1 PDB entry) |
Domain d4ylga_: 4ylg A: [273050] automated match to d3aq4a_ complexed with gdp, mg |
PDB Entry: 4ylg (more details), 1.8 Å
SCOPe Domain Sequences for d4ylga_:
Sequence, based on SEQRES records: (download)
>d4ylga_ c.37.1.8 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]} swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw dvggqdkirplwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfan khdlpqamsisevteklglqtiknrkwycqtscatngdglyegldwladnl
>d4ylga_ c.37.1.8 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]} swlskllgkkemrilmvgldaagktsilyklklgeivttiptigfnvetveyknisftvw dvgglwrhyyqntqaiifvvdsndrdrigeareelmkmlnedemrnaillvfankhdlpq amsisevteklglqtiknrkwycqtscatngdglyegldwladnl
Timeline for d4ylga_: