![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243 can form strand-exchange dimers |
![]() | Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
![]() | Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins) |
![]() | Protein automated matches [227065] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [273041] (10 PDB entries) |
![]() | Domain d4yc6d_: 4yc6 D: [273043] Other proteins in same PDB: d4yc6a_, d4yc6c_, d4yc6e_, d4yc6g_ automated match to d1dksa_ |
PDB Entry: 4yc6 (more details), 2.6 Å
SCOPe Domain Sequences for d4yc6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yc6d_ d.97.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep hillfrrplp
Timeline for d4yc6d_: