SCOPe 2.08: Domain d4xkba1: 4xkb A:3-82

Lineage for d4xkba1 (4xkb A:3-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.22: GUN4-associated domain [140825] (2 proteins)
   PfamB PB089177
   this is a repeat family; one repeat unit is 1z3x A:34-71 found in domain

6. Protein Mg-chelatase cofactor Gun4 [140826] (2 species)
   Ycf53-like protein sll0558

7. Species Synechocystis sp. [TaxId:1111708] [273033] (5 PDB entries)

8. Domain d4xkba1: 4xkb A:3-82 [273037]
   Other proteins in same PDB: d4xkba2
   automated match to d1y6ia1
   complexed with de9

Details for d4xkba1

PDB Entry: 4xkb, 1.5 Å

PDB Description: crystal structure of genomes uncoupled 4 (gun4) in complex with deuteroporphyrin ix

PDB Compounds: (A:) Ycf53-like protein

SCOPe Domain Sequences for d4xkba1:

Sequence, based on SEQRES records:

>d4xkba1 a.118.1.22 (A:3-82) Mg-chelatase cofactor Gun4 {Synechocystis sp. [TaxId: 1111708]}
dnltelsqqlhdasekkqltaiaalaemgeggqgilldylaknvplekpvlavgnvyqtl
rnleqetittqlqrnyptgi

Sequence, based on observed residues (ATOM records):

>d4xkba1 a.118.1.22 (A:3-82) Mg-chelatase cofactor Gun4 {Synechocystis sp. [TaxId: 1111708]}
dnltelsqqlkqltaiaalaemgeggqgilldylaknvplekpvlavgnvyqtlrnleqe
tittqlqrnyptgi

Timeline for d4xkba1:

• d4xkba1 first appeared in SCOPe 2.05
  
• d4xkba1 appears in SCOPe 2.07