SCOPe 2.08: Domain d4xkca2: 4xkc A:83-233

Lineage for d4xkca2 (4xkc A:83-233)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.261: GUN4-like [140868] (1 superfamily)
   multihelical; open array, trapping inside an extended region before the C-terminal helix

4. Superfamily a.261.1: GUN4-like [140869] (1 family)
   automatically mapped to Pfam PF05419

5. Family a.261.1.1: GUN4-like [140870] (2 proteins)
   Pfam PF05419

6. Protein Mg-chelatase cofactor Gun4 [140871] (2 species)
   Ycf53-like protein sll0558

7. Species Synechocystis sp. [TaxId:1111708] [273035] (5 PDB entries)

8. Domain d4xkca2: 4xkc A:83-233 [273036]
   Other proteins in same PDB: d4xkca1
   automated match to d1y6ia2
   complexed with md9

Details for d4xkca2

PDB Entry: 4xkc, 2 Å

PDB Description: crystal structure of genomes uncoupled 4 (gun4) in complex with magnesium deuteroporphyrin ix

PDB Compounds: (A:) Ycf53-like protein

SCOPe Domain Sequences for d4xkca2:

Sequence; same for both SEQRES and ATOM records:

>d4xkca2 a.261.1.1 (A:83-233) Mg-chelatase cofactor Gun4 {Synechocystis sp. [TaxId: 1111708]}
fplqsaqgidylplqealgsqdfetadeitrdklcelagpgasqrqwlyftevekfpald
lhtinalwwlhsngnfgfsvqrrlwlasgkeftklwpkigwksgnvwtrwpkgftwdlsa
pqghlpllnqlrgvrvaeslyrhpvwsqygw

Timeline for d4xkca2:

• d4xkca2 first appeared in SCOPe 2.05
  
• d4xkca2 appears in SCOPe 2.07