| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
| Family a.118.1.22: GUN4-associated domain [140825] (2 proteins) PfamB PB089177 this is a repeat family; one repeat unit is 1z3x A:34-71 found in domain |
| Protein Mg-chelatase cofactor Gun4 [140826] (2 species) Ycf53-like protein sll0558 |
| Species Synechocystis sp. [TaxId:1111708] [273033] (5 PDB entries) |
| Domain d4xkca1: 4xkc A:4-82 [273034] Other proteins in same PDB: d4xkca2 automated match to d1y6ia1 complexed with md9 |
PDB Entry: 4xkc (more details), 2 Å
SCOPe Domain Sequences for d4xkca1:
Sequence, based on SEQRES records: (download)
>d4xkca1 a.118.1.22 (A:4-82) Mg-chelatase cofactor Gun4 {Synechocystis sp. [TaxId: 1111708]}
nltelsqqlhdasekkqltaiaalaemgeggqgilldylaknvplekpvlavgnvyqtlr
nleqetittqlqrnyptgi
>d4xkca1 a.118.1.22 (A:4-82) Mg-chelatase cofactor Gun4 {Synechocystis sp. [TaxId: 1111708]}
nltelsqqlhkqltaiaalaemgeggqgilldylaknvplekpvlavgnvyqtlrnleqe
tittqlqrnyptgi
Timeline for d4xkca1: