Lineage for d4x5rb_ (4x5r B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771869Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1771874Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1771891Protein Mannose-specific adhesin FimH [49406] (2 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 1771978Species Escherichia coli [TaxId:83333] [273015] (4 PDB entries)
  8. 1771982Domain d4x5rb_: 4x5r B: [273023]
    automated match to d3zl2a_
    complexed with 3xo, so4

Details for d4x5rb_

PDB Entry: 4x5r (more details), 1.65 Å

PDB Description: crystal structure of fimh in complex with a squaryl-phenyl alpha-d- mannopyranoside derivative
PDB Compounds: (B:) protein fimh

SCOPe Domain Sequences for d4x5rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x5rb_ b.2.3.2 (B:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d4x5rb_:

Click to download the PDB-style file with coordinates for d4x5rb_.
(The format of our PDB-style files is described here.)

Timeline for d4x5rb_: