![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
![]() | Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
![]() | Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins) |
![]() | Protein automated matches [190153] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [273006] (2 PDB entries) |
![]() | Domain d3x21h_: 3x21 H: [273018] automated match to d1icub_ complexed with fmn; mutant |
PDB Entry: 3x21 (more details), 3 Å
SCOPe Domain Sequences for d3x21h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x21h_ d.90.1.1 (H:) automated matches {Escherichia coli [TaxId: 83333]} mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsslnsqpwhfivasteegkarv aksaagnyvfserkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg rkfwadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke kgytslvvvpvghhsvedfnatlpksrlpqnitltev
Timeline for d3x21h_: