Lineage for d3x21h_ (3x21 H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963275Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2963381Protein automated matches [190153] (5 species)
    not a true protein
  7. 2963400Species Escherichia coli [TaxId:83333] [273006] (2 PDB entries)
  8. 2963410Domain d3x21h_: 3x21 H: [273018]
    automated match to d1icub_
    complexed with fmn; mutant

Details for d3x21h_

PDB Entry: 3x21 (more details), 3 Å

PDB Description: crystal structure of escherichia coli nitroreductase nfsb mutant t41l/n71s/f124w
PDB Compounds: (H:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d3x21h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x21h_ d.90.1.1 (H:) automated matches {Escherichia coli [TaxId: 83333]}
mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsslnsqpwhfivasteegkarv
aksaagnyvfserkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
rkfwadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
kgytslvvvpvghhsvedfnatlpksrlpqnitltev

SCOPe Domain Coordinates for d3x21h_:

Click to download the PDB-style file with coordinates for d3x21h_.
(The format of our PDB-style files is described here.)

Timeline for d3x21h_: