Lineage for d4x5pa_ (4x5p A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040523Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2040544Protein Mannose-specific adhesin FimH [49406] (2 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 2040631Species Escherichia coli [TaxId:83333] [273015] (7 PDB entries)
  8. 2040632Domain d4x5pa_: 4x5p A: [273017]
    automated match to d3zl2a_
    complexed with 3xj

Details for d4x5pa_

PDB Entry: 4x5p (more details), 1 Å

PDB Description: crystal structure of fimh in complex with a benzoyl-amidophenyl alpha- d-mannopyranoside
PDB Compounds: (A:) protein fimh

SCOPe Domain Sequences for d4x5pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x5pa_ b.2.3.2 (A:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 83333]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d4x5pa_:

Click to download the PDB-style file with coordinates for d4x5pa_.
(The format of our PDB-style files is described here.)

Timeline for d4x5pa_: