Lineage for d3x21f_ (3x21 F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917190Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 1917191Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 1917192Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 1917277Protein automated matches [190153] (3 species)
    not a true protein
  7. 1917287Species Escherichia coli [TaxId:83333] [273006] (2 PDB entries)
  8. 1917295Domain d3x21f_: 3x21 F: [273010]
    automated match to d1icub_
    complexed with fmn; mutant

Details for d3x21f_

PDB Entry: 3x21 (more details), 3 Å

PDB Description: crystal structure of escherichia coli nitroreductase nfsb mutant t41l/n71s/f124w
PDB Compounds: (F:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d3x21f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x21f_ d.90.1.1 (F:) automated matches {Escherichia coli [TaxId: 83333]}
mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsslnsqpwhfivasteegkarv
aksaagnyvfserkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
rkfwadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
kgytslvvvpvghhsvedfnatlpksrlpqnitltev

SCOPe Domain Coordinates for d3x21f_:

Click to download the PDB-style file with coordinates for d3x21f_.
(The format of our PDB-style files is described here.)

Timeline for d3x21f_: