SCOP 1.65: Domain d2izdb_: 2izd B:

Lineage for d2izdb_ (2izd B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.61: Streptavidin-like [50875] (5 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (98 PDB entries)

8. Domain d2izdb_: 2izd B: [27301]

Details for d2izdb_

PDB Entry: 2izd, 1.6 Å

PDB Description: apostreptavidin ph 3.0 i222 complex

SCOP Domain Sequences for d2izdb_:

Sequence; same for both SEQRES and ATOM records:

>d2izdb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d2izdb_:

• d2izdb_ first appeared (with stable ids) in SCOP 1.55
  
• d2izdb_ appears in SCOP 1.63
  
• d2izdb_ appears in SCOP 1.67
  
• d2izdb_ appears in the current release, SCOPe 2.08