Lineage for d2izdb_ (2izd B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2063611Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2063612Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2063637Protein Streptavidin [50878] (1 species)
  7. 2063638Species Streptomyces avidinii [TaxId:1895] [50879] (125 PDB entries)
  8. 2063760Domain d2izdb_: 2izd B: [27301]
    complexed with cl, iod, nh4, so4

Details for d2izdb_

PDB Entry: 2izd (more details), 1.6 Å

PDB Description: apostreptavidin ph 3.0 i222 complex
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d2izdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izdb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOPe Domain Coordinates for d2izdb_:

Click to download the PDB-style file with coordinates for d2izdb_.
(The format of our PDB-style files is described here.)

Timeline for d2izdb_: