SCOPe 2.06: Domain d3wsua1: 3wsu A:53-349

Lineage for d3wsua1 (3wsu A:53-349)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (26 species)
   not a true protein

7. Species Streptomyces thermolilacinus [TaxId:285540] [272999] (2 PDB entries)

8. Domain d3wsua1: 3wsu A:53-349 [273001]
   Other proteins in same PDB: d3wsua2
   automated match to d1bqca_
   complexed with gol, na

Details for d3wsua1

PDB Entry: 3wsu, 1.6 Å

PDB Description: crystal structure of beta-mannanase from streptomyces thermolilacinus

PDB Compounds: (A:) beta-mannanase

SCOPe Domain Sequences for d3wsua1:

Sequence; same for both SEQRES and ATOM records:

>d3wsua1 c.1.8.3 (A:53-349) automated matches {Streptomyces thermolilacinus [TaxId: 285540]}
glhvqggrllegngndfvmrgvnhahtwypgqtrsladikalgantvrvvlsdghrwtrn
gpadvaavidrckanrlicvlevhdttgygeepaagtldhaadywislmdvlagqedyvi
vnignepwgntdpagwtaptiaavkklraaglahtlmidapnwgqdwqgvmradarsvye
adptgnllfsihmysvfdtaaeiddyleafvdaglplvigefggppdqwgdpdedtmlaa
aerlrlgylawswsgntdpvldlaigfdpdrlsgwgqrvfhgvhgigetsreatvfg

Timeline for d3wsua1:

• d3wsua1 first appeared in SCOPe 2.05, called d3wsua_
  
• d3wsua1 appears in SCOPe 2.07
  
• d3wsua1 appears in the current release, SCOPe 2.08