SCOPe 2.06: Domain d3wsub_: 3wsu B:

Lineage for d3wsub_ (3wsu B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (26 species)
   not a true protein

7. Species Streptomyces thermolilacinus [TaxId:285540] [272999] (2 PDB entries)

8. Domain d3wsub_: 3wsu B: [273000]
   Other proteins in same PDB: d3wsua2
   automated match to d1bqca_
   complexed with gol, na

Details for d3wsub_

PDB Entry: 3wsu, 1.6 Å

PDB Description: crystal structure of beta-mannanase from streptomyces thermolilacinus

PDB Compounds: (B:) beta-mannanase

SCOPe Domain Sequences for d3wsub_:

Sequence; same for both SEQRES and ATOM records:

>d3wsub_ c.1.8.3 (B:) automated matches {Streptomyces thermolilacinus [TaxId: 285540]}
tglhvqggrllegngndfvmrgvnhahtwypgqtrsladikalgantvrvvlsdghrwtr
ngpadvaavidrckanrlicvlevhdttgygeepaagtldhaadywislmdvlagqedyv
ivnignepwgntdpagwtaptiaavkklraaglahtlmidapnwgqdwqgvmradarsvy
eadptgnllfsihmysvfdtaaeiddyleafvdaglplvigefggppdqwgdpdedtmla
aaerlrlgylawswsgntdpvldlaigfdpdrlsgwgqrvfhgvhgigetsreatvfg

Timeline for d3wsub_:

• d3wsub_ first appeared in SCOPe 2.05
  
• d3wsub_ appears in SCOPe 2.07
  
• d3wsub_ appears in the current release, SCOPe 2.08