SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3wsub_ (3wsu B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082782Protein automated matches [190057] (25 species)
    not a true protein
  7. 2082886Species Streptomyces thermolilacinus [TaxId:285540] [272999] (2 PDB entries)
  8. 2082890Domain d3wsub_: 3wsu B: [273000]
    Other proteins in same PDB: d3wsua2
    automated match to d1bqca_
    complexed with gol, na

Details for d3wsub_

PDB Entry: 3wsu (more details), 1.6 Å

PDB Description: crystal structure of beta-mannanase from streptomyces thermolilacinus
PDB Compounds: (B:) beta-mannanase

SCOPe Domain Sequences for d3wsub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wsub_ c.1.8.3 (B:) automated matches {Streptomyces thermolilacinus [TaxId: 285540]}
tglhvqggrllegngndfvmrgvnhahtwypgqtrsladikalgantvrvvlsdghrwtr
ngpadvaavidrckanrlicvlevhdttgygeepaagtldhaadywislmdvlagqedyv
ivnignepwgntdpagwtaptiaavkklraaglahtlmidapnwgqdwqgvmradarsvy
eadptgnllfsihmysvfdtaaeiddyleafvdaglplvigefggppdqwgdpdedtmla
aaerlrlgylawswsgntdpvldlaigfdpdrlsgwgqrvfhgvhgigetsreatvfg

SCOPe Domain Coordinates for d3wsub_:

Click to download the PDB-style file with coordinates for d3wsub_.
(The format of our PDB-style files is described here.)

Timeline for d3wsub_: