Lineage for d4rwqb1 (4rwq B:1-200)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239280Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2239281Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2239616Family d.218.1.6: 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain [102937] (1 protein)
    similar overall structure to the first two domains of poly(A) polymerase, PAP
  6. 2239617Protein 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain [102938] (2 species)
  7. 2239620Species Pig (Sus scrofa) [TaxId:9823] [102939] (2 PDB entries)
  8. 2239624Domain d4rwqb1: 4rwq B:1-200 [272983]
    Other proteins in same PDB: d4rwqa2, d4rwqb2
    automated match to d1px5a2

Details for d4rwqb1

PDB Entry: 4rwq (more details), 3.1 Å

PDB Description: crystal structure of the apo-state of porcine oas1
PDB Compounds: (B:) 2'-5'-oligoadenylate synthase 1

SCOPe Domain Sequences for d4rwqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rwqb1 d.218.1.6 (B:1-200) 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
melrhtpardldkfiedhllpntcfrtqvkeaidivcrflkercfqgtadpvrvskvvkg
gssgkgttlrgrsdadlvvfltkltsfedqlrrrgefiqeirrqleacqreqkfkvtfev
qsprrenpralsfvlsspqlqqevefdvlpafdalgqwtpgykpnpeiyvqlikecksrg
kegefstcftelqrdflrnr

SCOPe Domain Coordinates for d4rwqb1:

Click to download the PDB-style file with coordinates for d4rwqb1.
(The format of our PDB-style files is described here.)

Timeline for d4rwqb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rwqb2