SCOPe 2.05: Domain d2rufa_: 2ruf A:

Lineage for d2rufa_ (2ruf A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.2: PDI-like [52849] (3 proteins)
   duplication: contains two tandem repeats of this fold

6. Protein automated matches [254585] (1 species)
   not a true protein

7. Species Fungus (Humicola insolens) [TaxId:34413] [255369] (3 PDB entries)

8. Domain d2rufa_: 2ruf A: [272982]
   automated match to d2kp1a_

Details for d2rufa_

PDB Entry: 2ruf

PDB Description: solution structure of the a' domain of thermophilic fungal protein disulfide (reduced form, 303k)

PDB Compounds: (A:) Protein disulfide-isomerase

SCOPe Domain Sequences for d2rufa_:

Sequence; same for both SEQRES and ATOM records:

>d2rufa_ c.47.1.2 (A:) automated matches {Fungus (Humicola insolens) [TaxId: 34413]}
gplgsegpvtvvvaknyneivlddtkdvliefyapwcghckalapkyeelgalyaksefk
drvviakvdatandvpdeiqgfptiklypagakgqpvtysgsrtvedlikfiaengkyka
a

Timeline for d2rufa_:

• d2rufa_ is new in SCOPe 2.05-stable
  
• d2rufa_ is called d2rufa1 in SCOPe 2.06
  
• d2rufa_ appears in the current release, SCOPe 2.08, called d2rufa1