SCOPe 2.07: Domain d4rwqa2: 4rwq A:201-346

Lineage for d4rwqa2 (4rwq A:201-346)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.2: 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101271] (1 protein)
   automatically mapped to Pfam PF10421

6. Protein 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101272] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [101273] (2 PDB entries)

8. Domain d4rwqa2: 4rwq A:201-346 [272981]
   Other proteins in same PDB: d4rwqa1, d4rwqb1
   automated match to d1px5a1

Details for d4rwqa2

PDB Entry: 4rwq, 3.1 Å

PDB Description: crystal structure of the apo-state of porcine oas1

PDB Compounds: (A:) 2'-5'-oligoadenylate synthase 1

SCOPe Domain Sequences for d4rwqa2:

Sequence; same for both SEQRES and ATOM records:

>d4rwqa2 a.160.1.2 (A:201-346) 2'-5'-oligoadenylate synthetase 1, OAS1, second domain {Pig (Sus scrofa) [TaxId: 9823]}
ptklkslirlvkhwyqtckkthgnklppqyalelltvyaweqgsrktdfstaqgfqtvle
lvlkhqklcifweayydftnpvvgrcmlqqlkkprpvildpadptgnvgggdthswqrla
qearvwlgypccknldgslvgawtml

Timeline for d4rwqa2:

• d4rwqa2 first appeared in SCOPe 2.05
  
• d4rwqa2 appears in SCOPe 2.06
  
• d4rwqa2 appears in the current release, SCOPe 2.08