Lineage for d4rwqa2 (4rwq A:201-346)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017952Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 2017953Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 2017969Family a.160.1.2: 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101271] (1 protein)
    automatically mapped to Pfam PF10421
  6. 2017970Protein 2'-5'-oligoadenylate synthetase 1, OAS1, second domain [101272] (2 species)
  7. 2017973Species Pig (Sus scrofa) [TaxId:9823] [101273] (2 PDB entries)
  8. 2017976Domain d4rwqa2: 4rwq A:201-346 [272981]
    Other proteins in same PDB: d4rwqa1, d4rwqb1
    automated match to d1px5a1

Details for d4rwqa2

PDB Entry: 4rwq (more details), 3.1 Å

PDB Description: crystal structure of the apo-state of porcine oas1
PDB Compounds: (A:) 2'-5'-oligoadenylate synthase 1

SCOPe Domain Sequences for d4rwqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rwqa2 a.160.1.2 (A:201-346) 2'-5'-oligoadenylate synthetase 1, OAS1, second domain {Pig (Sus scrofa) [TaxId: 9823]}
ptklkslirlvkhwyqtckkthgnklppqyalelltvyaweqgsrktdfstaqgfqtvle
lvlkhqklcifweayydftnpvvgrcmlqqlkkprpvildpadptgnvgggdthswqrla
qearvwlgypccknldgslvgawtml

SCOPe Domain Coordinates for d4rwqa2:

Click to download the PDB-style file with coordinates for d4rwqa2.
(The format of our PDB-style files is described here.)

Timeline for d4rwqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rwqa1