Lineage for d2ruea1 (2rue A:6-121)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876524Family c.47.1.2: PDI-like [52849] (3 proteins)
    duplication: contains two tandem repeats of this fold
  6. 2876571Protein automated matches [254585] (1 species)
    not a true protein
  7. 2876572Species Fungus (Humicola insolens) [TaxId:34413] [255369] (4 PDB entries)
  8. 2876574Domain d2ruea1: 2rue A:6-121 [272979]
    Other proteins in same PDB: d2ruea2
    automated match to d2kp1a_

Details for d2ruea1

PDB Entry: 2rue (more details)

PDB Description: solution structure of the a' domain of thermophilic fungal protein disulfide (oxidized form, 303k)
PDB Compounds: (A:) Protein disulfide-isomerase

SCOPe Domain Sequences for d2ruea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ruea1 c.47.1.2 (A:6-121) automated matches {Fungus (Humicola insolens) [TaxId: 34413]}
egpvtvvvaknyneivlddtkdvliefyapwcghckalapkyeelgalyaksefkdrvvi
akvdatandvpdeiqgfptiklypagakgqpvtysgsrtvedlikfiaengkykaa

SCOPe Domain Coordinates for d2ruea1:

Click to download the PDB-style file with coordinates for d2ruea1.
(The format of our PDB-style files is described here.)

Timeline for d2ruea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ruea2