SCOPe 2.06: Domain d4rhuf_: 4rhu F:

Lineage for d4rhuf_ (4rhu F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (32 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [272972] (5 PDB entries)

8. Domain d4rhuf_: 4rhu F: [272977]
   automated match to d3kb8b_
   complexed with 3qe, 45t, mg

Details for d4rhuf_

PDB Entry: 4rhu, 2.57 Å

PDB Description: crystal structures of mycobacterium tuberculosis 6-oxopurine phosphoribosyltransferase which is a potential target for drug development against this disease

PDB Compounds: (F:) Hypoxanthine-guanine phosphoribosyltransferase Hpt

SCOPe Domain Sequences for d4rhuf_:

Sequence, based on SEQRES records:

>d4rhuf_ c.61.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
elypgdiksvlltaeqiqariaelgeqigndyrelsattgqdlllitvlkgavlfvtdla
raipvptqfefmavssygsstsssgvvrilkdldrdihgrdvlivedvvdsgltlswlsr
nltsrnprslrvctllrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtl
dprvyq

Sequence, based on observed residues (ATOM records):

>d4rhuf_ c.61.1.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
elypgdiksvlltaeqiqariaelgeqigndyrgqdlllitvlkgavlfvtdlaraipvp
tqfefmavssyvvrilkdldrdihgrdvlivedvvdsgltlswlsrnltsrnprslrvct
llrkpdavhanveiayvgfdipndfvvgygldyderyrdlsyigtldprvyq

Timeline for d4rhuf_:

• d4rhuf_ first appeared in SCOPe 2.05
  
• d4rhuf_ appears in SCOPe 2.07
  
• d4rhuf_ appears in the current release, SCOPe 2.08