Lineage for d4qf6l_ (4qf6 L:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141104Species Bacillus cereus [TaxId:526980] [269753] (7 PDB entries)
  8. 2141116Domain d4qf6l_: 4qf6 L: [272971]
    automated match to d4fr8a_
    complexed with na; mutant

Details for d4qf6l_

PDB Entry: 4qf6 (more details), 1.9 Å

PDB Description: structure of aldehyde dehydrogenase from bacillus cereus, e194s mutant
PDB Compounds: (L:) aldehyde dehydrogenase

SCOPe Domain Sequences for d4qf6l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qf6l_ c.82.1.0 (L:) automated matches {Bacillus cereus [TaxId: 526980]}
elkpkveaflneeikmfingefvsaiggktfetynpatedvlavvceaqeedidaavkaa
rsafesgpwaemttaerahliykladlieehreelaqlealdngkpyqvaldddisatve
nyryyagwttkiigqtipiskdylnytrhepvgvvgqiipwnfplvmsswkmgaalatgc
tivlkpasqtplsllyaaklfkeagfpngvvnfvpgfgpeagaaivnhhdidkvaftgst
vtgkyimrqsaemikhvtlelggkspniiledadleeaingafqgimynhgqncsagsrv
fvhrkhyetvvdalvkmannvklgagmeketemgplvskkqqervlnyieqgkkegatva
aggeralekgyfvkptvftdvtddmtivkeeifgpvvvvlpfdsteevierannssygla
agvwtqniktghqvanklkagtvwindynlenaaapfggykqsgigrelgsyaldnytev
ksvwvnik

SCOPe Domain Coordinates for d4qf6l_:

Click to download the PDB-style file with coordinates for d4qf6l_.
(The format of our PDB-style files is described here.)

Timeline for d4qf6l_: