SCOPe 2.08: Domain d4qdvb2: 4qdv B:146-336

Lineage for d4qdvb2 (4qdv B:146-336)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 proteins)

6. Protein automated matches [254454] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [254968] (5 PDB entries)

8. Domain d4qdvb2: 4qdv B:146-336 [272946]
   Other proteins in same PDB: d4qdva1, d4qdvb1, d4qdvc1, d4qdvd1
   automated match to d1st0a1
   complexed with 30u, gol, po4

Details for d4qdvb2

PDB Entry: 4qdv, 2.8 Å

PDB Description: dcps in complex with covalent ligand

PDB Compounds: (B:) m7GpppX diphosphatase

SCOPe Domain Sequences for d4qdvb2:

Sequence; same for both SEQRES and ATOM records:

>d4qdvb2 d.13.1.3 (B:146-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqq

Timeline for d4qdvb2:

• d4qdvb2 first appeared in SCOPe 2.05
  
• d4qdvb2 appears in SCOPe 2.07