SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4qdvb2 (4qdv B:146-336)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157128Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2157129Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2157268Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (2 protein domains)
  6. 2157284Protein automated matches [254454] (1 species)
    not a true protein
  7. 2157285Species Human (Homo sapiens) [TaxId:9606] [254968] (4 PDB entries)
  8. 2157293Domain d4qdvb2: 4qdv B:146-336 [272946]
    Other proteins in same PDB: d4qdva1, d4qdvb1, d4qdvc1, d4qdvd1
    automated match to d1st0a1
    complexed with 30u, gol, po4

Details for d4qdvb2

PDB Entry: 4qdv (more details), 2.8 Å

PDB Description: dcps in complex with covalent ligand
PDB Compounds: (B:) m7GpppX diphosphatase

SCOPe Domain Sequences for d4qdvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qdvb2 d.13.1.3 (B:146-336) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdlrliretgddyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipd
lkwnqqqlddlyliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrv
ylhylpsyyhlhvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalradd
pllkllqeaqq

SCOPe Domain Coordinates for d4qdvb2:

Click to download the PDB-style file with coordinates for d4qdvb2.
(The format of our PDB-style files is described here.)

Timeline for d4qdvb2: