SCOPe 2.06: Domain d4qceb_: 4qce B:

Lineage for d4qceb_ (4qce B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (26 species)
   not a true protein

7. Species Bacillus sp. [TaxId:65673] [187690] (9 PDB entries)

8. Domain d4qceb_: 4qce B: [272944]
   automated match to d2fgla_
   complexed with mg, na

Details for d4qceb_

PDB Entry: 4qce, 2.32 Å

PDB Description: crystal structure of recombinant alkali thermostable gh10 xylanase from bacillus sp. ng-27

PDB Compounds: (B:) alkaline thermostable endoxylanase

SCOPe Domain Sequences for d4qceb_:

Sequence; same for both SEQRES and ATOM records:

>d4qceb_ c.1.8.3 (B:) automated matches {Bacillus sp. [TaxId: 65673]}
vqpfawqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpee
gvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqanke
lllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafe
tarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptide
irtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyee
ldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid

Timeline for d4qceb_:

• d4qceb_ first appeared in SCOPe 2.05
  
• d4qceb_ appears in SCOPe 2.07
  
• d4qceb_ appears in the current release, SCOPe 2.08